site stats

Fggy carbohydrate kinase family

WebOct 20, 2024 · The Fggy gene belongs to an evolutionarily related family of carbohydrate kinases that has been found to phosphorylate an array of sugar substrates (Zhang et al., …

Fggy Carbohydrate Kinase Domain Containing is Induced …

WebOct 20, 2024 · The Fggy gene belongs to an evolutionarily related family of carbohydrate kinases that has been found to phosphorylate an array of sugar substrates ( Zhang et al., … WebMay 19, 2016 · Expression of FGGY is significantly lower in the red factor canary than in the yellow canary, the opposite of what one would expect for a ketolase. Furthermore, FGGY encodes a protein with homology to a family of kinases … hifi keten mediamarkt https://chepooka.net

Early Error - genome.ucsc.edu

WebZhang Y, Zagnitko O, Rodionova I, Osterman A, Godzik A. (2011) The FGGY carbohydrate kinase family: insights into the evolution of functional specificities. PLoS Computational Biology 7(12): e1002318. WebCarbohydrate kinase FGGY C-terminal InterPro annotation BLAST Add Sequence: AVICGTSSCHMGISKDPIFVPGVWGPYFSAMVPGFWLNEGGQSVTGKLIDHMVQGHAAFPELQVKATARCQSIYAYLNSHLDLIKKAQPVGFLTVDLHVWPDFHGNRSPLADLTLKGMVTGLKLSQDLDDLAILYLATVQAIALGTRFIIEAMEAAGHSISTLFLCGGLSKNPLFVQMHADITGMPVVLSQEVESVLVGAAVLGACA WebFGGY carbohydrate kinase domain containing Symbol fggy Nomenclature History Previous Names. zgc:85818; Type protein_coding_gene Location Chr: 2 Mapping … hifikepunye pohamba

Pfam: Family: FGGY_C (PF02782)

Category:UniProt

Tags:Fggy carbohydrate kinase family

Fggy carbohydrate kinase family

ZFIN Gene: fggy - Zebrafish Information Network

WebIrina RODIONOVA, PhD Cited by 1,411 of University of California, San Diego, California (UCSD) Read 91 publications Contact Irina RODIONOVA WebJun 17, 2014 · Eight candidate genes, S100P, AKR1C3, CNN3, AKR1B1, MACC1, HBE1, TFF3, and FGGY, were selected on the basis of their remarkable overexpression in SW620 cells and unlikable to be related to inflammation (Table 1 ). We were examined these genes in tissues and LNs of 14 colorectal cancer patients and 11 controls by real-time qRT-PCR.

Fggy carbohydrate kinase family

Did you know?

WebThis subfamily is composed of uncharacterized carbohydrate kinases. They are sequence homologous to bacterial glycerol kinase and have been classified as members of the FGGY family of carbohydrate kinases. The monomers of FGGY proteins contain two large domains, which are separated by a deep cleft that forms the active site. WebDescription: Homo sapiens glycerol kinase (GK), transcript variant 2, mRNA. RefSeq Summary (NM_000167): The protein encoded by this gene belongs to the FGGY kinase family. This protein is a key enzyme in the regulation of glycerol uptake and metabolism. It catalyzes the phosphorylation of glycerol by ATP, yielding ADP and glycerol-3-phosphate.

WebThe microarray revealed that Fggy carbohydrate kinase domain containing (Fggy) is expressed in skeletal muscle and is induced in response to denervation. Bioinformatic … WebPredicted to be involved in carbohydrate phosphorylation and pentose metabolic process. Predicted to act upstream of or within carbohydrate metabolic process and phosphorylation. Predicted to be active in cytoplasm. Orthologous to human FGGY (FGGY carbohydrate kinase domain containing). Genome Resources Alliance ( 1) …

WebTo better characterize the molecular genetic events of atrophy, a microarray analysis revealed that FGGY carbohydrate kinase domain containing (Fggy) is expressed in skeletal muscle and is... WebDescription:Homo sapiens FGGY carbohydrate kinase domain containing (FGGY), transcript variant 4, mRNA. (from RefSeq NM_001278224) RefSeq Summary (NM_018291):This gene encodes a protein that phosphorylates carbohydrates such as ribulose, ribitol, and L-arabinitol.

WebThe three-dimensional structures of Escherichia coli glycerol kinase (GK) with bound glycerol in the presence and absence of one of the allosteric regulators of its activity, fructose 1,6-bisphosphate (FBP), at 3.2 and 3.0 Å, are presented. The molecule crystallized in space group P41212, and the structure was solved by molecular replacement. The …

WebOct 2, 2024 · FGGY family of carbohydrate kinases. This family is predominantly composed of glycerol kinase (GK) and similar carbohydrate kinases including … hifi ipadWebFGGY carbohydrate kinase domain containing. Gene. FGGY. Status. UniProtKB unreviewed (TrEMBL) Organism. Homo sapiens (Human) Amino acids. 514. ... Belongs to the FGGY kinase family. automatic annotation. Phylogenomic databases. GeneTree. ENSGT01000000214434; Family and domain databases. CDD. cd07782 … hifikepunye pohamba campus ongwedivaWebThe AraC family regulators are an abundant group of TRs in bacteria, mostly acting as gene expression activators, controlling diverse cellular functions (e.g., carbon metabolism, stress response, and virulence). ... PA3024 encodes a putative FGGY carbohydrate kinase carrying out ATP-dependent phosphorylation of glycerol . Three other enzymes ... hifi kemper ulmWebIn addition, FGGY carbohydrate kinases contributed plant adenosine and thriphosphate (ATP)-dependent phosphorylation of nine distinct sugar enzymes. These enzymes include L-fucolokinase, gluconokinase, glycerol kinase, xylulokinase, D-ribulose kinase and L-xylulose kinase [ 22 ]. hifi klubben 10 rabattWebFeb 20, 2014 · FGGY is an enzyme of the carbohydrate kinase type. ... The FGGY carbohydrate kinase family: insights. into the evolution of functional specificities. PLoS Com-put. Biol., 7, e1002318. hifikepunye pohamba campusWebDec 22, 2011 · Here, using the FGGY carbohydrate kinase family as an example, we built a confidently annotated reference set (CARS) of proteins by propagating experimentally verified functional assignments to a … ezk begroting 2023WebDescription: Homo sapiens glycerol kinase (GK), transcript variant 1, mRNA. RefSeq Summary (NM_203391): The protein encoded by this gene belongs to the FGGY kinase family. This protein is a key enzyme in the regulation of glycerol uptake and metabolism. It catalyzes the phosphorylation of glycerol by ATP, yielding ADP and glycerol-3-phosphate. hifikepunye pohamba foundation